(data stored in ACNUC7421 zone)

EMBL: CP001658.PE572

CP001658.PE572       Location/Qualifiers
FT   CDS             646559..648223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00560"
FT                   /product="bifunctional menaquinone biosynthesis protein
FT                   menD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23593"
FT                   /protein_id="ACT23593.1"
FT                   /translation="MNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALQDADRSG
FT                   RIRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLS
FT                   ANRPYELLGTGANQTMEQLGYFGTQVRASISLGLAEDAPERTSALNATWRSATCRVLAA
FT                   ATGARTANAGPVHFDIPLREPLVPDPEPLGAVTPPGRPAGKPWTYTPPVTFDQPLDIDL
FT                   SVDTVVISGHGAGVHPNLAALPTVAEPTAPRSGDNPLHPLALPLLRPQQVIMLGRPTLH
FT                   RPVSVLLADAEVPVFALTTGPRWPDVSGNSQATGTRAVTTGAPRPAWLDRCAAMNRHAI
FT                   AAVREQLAAHPLTTGLHVAAAVSHALRPGDQLVLGASNPVRDVALAGLDTRGIRVRSNR
FT                   GVAGIDGTVSTAIGAALAYEGAHERTGSPDSPPRTIALIGDLTFVHDSSGLLIGPTEPI
FT                   PRSLTIVVSNDNGGGIFELLEQGDPRFSDVSSRIFGTPHDVDVGALCRAYHVESRQIEV
FT                   DELGPTLDQPGAGMRVLEVKADRSSLRQLHAAIKAAL"
     MNPSTTQARV VVDELIRGGV RDVVLCPGSR NAPLAFALQD ADRSGRIRLH VRIDERTAGY        60
     LAIGLAIGAG APVCVAMTSG TAVANLGPAV VEANYARVPL IVLSANRPYE LLGTGANQTM       120
     EQLGYFGTQV RASISLGLAE DAPERTSALN ATWRSATCRV LAAATGARTA NAGPVHFDIP       180
     LREPLVPDPE PLGAVTPPGR PAGKPWTYTP PVTFDQPLDI DLSVDTVVIS GHGAGVHPNL       240
     AALPTVAEPT APRSGDNPLH PLALPLLRPQ QVIMLGRPTL HRPVSVLLAD AEVPVFALTT       300
     GPRWPDVSGN SQATGTRAVT TGAPRPAWLD RCAAMNRHAI AAVREQLAAH PLTTGLHVAA       360
     AVSHALRPGD QLVLGASNPV RDVALAGLDT RGIRVRSNRG VAGIDGTVST AIGAALAYEG       420
     AHERTGSPDS PPRTIALIGD LTFVHDSSGL LIGPTEPIPR SLTIVVSNDN GGGIFELLEQ       480
     GDPRFSDVSS RIFGTPHDVD VGALCRAYHV ESRQIEVDEL GPTLDQPGAG MRVLEVKADR       540
     SSLRQLHAAI KAAL                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page