(data stored in ACNUC7421 zone)

EMBL: CP001658.PE588

CP001658.PE588       Location/Qualifiers
FT   CDS             complement(663748..665079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23609"
FT                   /protein_id="ACT23609.1"
FT                   /translation="MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKS
FT                   LQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIE
FT                   LQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPD
FT                   DIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDA
FT                   AADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVFAHGSGSSRHSIRNRYVAEVLTGA
FT                   GFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAG
FT                   AALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVI
FT                   PGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG"
     MKLFDDRGDA GRQLAQRLAQ LSGKAVVVLG LPRGGVPVAF EVAKSLQAPL DVLVVRKLGV        60
     PFQPELAFGA IGEDGVRVLN DDVVRGTHLD AAAMDAVERK QLIELQRRAE RFRRGRDRIP       120
     LTGRIAVIVD DGIATGATAK AACQVARAHG ADKVVLAVPI GPDDIVARFA GYADEVVCLA       180
     TPALFFAVGQ GYRNFTQTSD DEVVAFLDRA HRDFAEAGAI DAAADPPLRD EEVQVVAGPV       240
     PVAGHLTVPE KPRGIVVFAH GSGSSRHSIR NRYVAEVLTG AGFATLLFDL LTPEEERNRA       300
     NVFDIELLAS RLIDVTGWLA TQPDTASLPV GYFGASTGAG AALVAAADPR VNVRAVVSRG       360
     GRPDLAGDSL GSVVAPTLLI VGGRDQVVLE LNQRAQAVIP GKCQLTVVPG ATHLFEEPGT       420
     LEQVAKLACD WFIDHLCGPG PSG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page