(data stored in ACNUC7421 zone)

EMBL: CP001658.PE59

CP001658.PE59        Location/Qualifiers
FT   CDS             63303..63995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23080"
FT                   /protein_id="ACT23080.1"
FT                   /translation="MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGR
FT                   LLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKG
FT                   HSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLC
FT                   QRQWHNTDDDPNRQSRRAAEILVYGHVLFELVSYVCCYNTETMTRVRTLLDPVGGVRKY
FT                   VIKPGMYY"
     MITRYKPESG FVARSGGPDR KRPHDWIVWH FTHADNLPGI ITAGRLLADS AVTPTTEVAY        60
     NPVKELRRHK VVAPDSRYPA SMASDHVPFY IAARSPMLYV VCKGHSGYSG GAGPLVHLGV       120
     ALGDIIDADL TWCASDGNAA ASYTKFSRQV DTLGTFVDFD LLCQRQWHNT DDDPNRQSRR       180
     AAEILVYGHV LFELVSYVCC YNTETMTRVR TLLDPVGGVR KYVIKPGMYY                  230
//

If you have problems or comments...

PBIL Back to PBIL home page