(data stored in ACNUC7421 zone)

EMBL: CP001658.PE596

CP001658.PE596       Location/Qualifiers
FT   CDS             complement(672257..676168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03991"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23617"
FT                   /protein_id="ACT23617.1"
FT                   /translation="MSFVIATPEMLTTAATDLAKIGSTITAANTAAAAVAKVLPASADE
FT                   VSVAVAALFGTHAQEYQTVSAQVATFHDRFVQTLSATASSYVAAEAVNVEQSLLAAVNA
FT                   PTQALFGRPLIGNGADGSPGTGQAGGPGGILYGNGGNGGSGAPGQRGGAGGAAGLIGNG
FT                   GNGGAGGVGTTGGAGGHGGAGGWLYGNGGAGGFGGAGAVGGNGGAGGTAGLFGVGGAGG
FT                   AGGNGIAGVTGTSASTPGGSGTAGGAGGIGGNGGAGGAGGVLMGNGGNGGAGGEGGPGG
FT                   AGGAGASGAHATNLGADGQAGGNGGNGGAGGTGGVGGPGGGHGLLGLGGSHGAGGAGGS
FT                   GGDGGAPGDGGNGATGTWGHNLGAGGTGGNGGNPGAGGAGGAGGASVGGSAHGANGAPG
FT                   TTSTSGGNGGDGGKGADAISSGQTGANGGRGGDGGQVGNGGAGGAGGRGGAGGLGFGSE
FT                   APGRPGGAGGTGGAGGNGGTQAGDGGTGGAGGAGGDGGSGGAGSIGFNASAPGAAGSPG
FT                   GNGGNGGPGGAGGEGGAGGLALAASGQNGSQGAGGDGGAGGNGGTPGNGGHGAAGALGV
FT                   NGGVGGAGGHGGDPGVGGAGGQGGSGSTPGANGAPGNTPTSGGNGGNGGRGADATGFGQ
FT                   TGASGGRGGDGGLVGNGGAGGAGGNGSKGLPGLGRLGNPGLDGGTGGNGGAGGSGGAWA
FT                   GNGGTGGAGGTGGVGGTGGSGSDGVNGSSAGADGHPGGTGGVGGTGGKGGDGGDGGAAP
FT                   NGVAGSQGPGGAGGDGGTGGVGGNGGRGIDGADGATAGARGQDGGAGGAGGKGGRGGTG
FT                   GPGGAGPAGTTGSQGAGGNGGSGGTGGDPGDGGNGANGSVFTNNGIGGNGGNGGNAGPS
FT                   GAGGSGGAGSTFGATGSSSSIHVNGGNGGNGGNGDHALSGNGAAGGNGGNGGNGSLRGS
FT                   GGAGGHGGNGGNASRGMGGDGGTGGAGGNAGQIGNGGAGGNGGDGGTGSDGNPGAITGS
FT                   GGRGGDGGVGGQGGSVAGDGADGGRGGAGGTGGTGLRGTTGATGATGTFDAGADGHGGN
FT                   GGTGGVGGTGGAGGGGGNGGAGGKALSPTGNNGSQGAGGDGGAGGAGGTGGTGGDGGRG
FT                   AHGTLFSSLAGTGGTGGNGGTGGTGGAGGAGGTGSTLGATGATGAAGRAGNGGVGGSGG
FT                   LGSAFGPGGTGGMGGAGGTSTVSAGGDGGRGGFGGDGLDASSGGNGGDGGHGGDGFRTA
FT                   GAGGRGGDGGKGADPGGLFPIPGAGGKGGTGGTGGTAHLGPLAIIGQSGQPGQFGSPGA
FT                   DGRGGAGGAGGGGGAGGSF"
     MSFVIATPEM LTTAATDLAK IGSTITAANT AAAAVAKVLP ASADEVSVAV AALFGTHAQE        60
     YQTVSAQVAT FHDRFVQTLS ATASSYVAAE AVNVEQSLLA AVNAPTQALF GRPLIGNGAD       120
     GSPGTGQAGG PGGILYGNGG NGGSGAPGQR GGAGGAAGLI GNGGNGGAGG VGTTGGAGGH       180
     GGAGGWLYGN GGAGGFGGAG AVGGNGGAGG TAGLFGVGGA GGAGGNGIAG VTGTSASTPG       240
     GSGTAGGAGG IGGNGGAGGA GGVLMGNGGN GGAGGEGGPG GAGGAGASGA HATNLGADGQ       300
     AGGNGGNGGA GGTGGVGGPG GGHGLLGLGG SHGAGGAGGS GGDGGAPGDG GNGATGTWGH       360
     NLGAGGTGGN GGNPGAGGAG GAGGASVGGS AHGANGAPGT TSTSGGNGGD GGKGADAISS       420
     GQTGANGGRG GDGGQVGNGG AGGAGGRGGA GGLGFGSEAP GRPGGAGGTG GAGGNGGTQA       480
     GDGGTGGAGG AGGDGGSGGA GSIGFNASAP GAAGSPGGNG GNGGPGGAGG EGGAGGLALA       540
     ASGQNGSQGA GGDGGAGGNG GTPGNGGHGA AGALGVNGGV GGAGGHGGDP GVGGAGGQGG       600
     SGSTPGANGA PGNTPTSGGN GGNGGRGADA TGFGQTGASG GRGGDGGLVG NGGAGGAGGN       660
     GSKGLPGLGR LGNPGLDGGT GGNGGAGGSG GAWAGNGGTG GAGGTGGVGG TGGSGSDGVN       720
     GSSAGADGHP GGTGGVGGTG GKGGDGGDGG AAPNGVAGSQ GPGGAGGDGG TGGVGGNGGR       780
     GIDGADGATA GARGQDGGAG GAGGKGGRGG TGGPGGAGPA GTTGSQGAGG NGGSGGTGGD       840
     PGDGGNGANG SVFTNNGIGG NGGNGGNAGP SGAGGSGGAG STFGATGSSS SIHVNGGNGG       900
     NGGNGDHALS GNGAAGGNGG NGGNGSLRGS GGAGGHGGNG GNASRGMGGD GGTGGAGGNA       960
     GQIGNGGAGG NGGDGGTGSD GNPGAITGSG GRGGDGGVGG QGGSVAGDGA DGGRGGAGGT      1020
     GGTGLRGTTG ATGATGTFDA GADGHGGNGG TGGVGGTGGA GGGGGNGGAG GKALSPTGNN      1080
     GSQGAGGDGG AGGAGGTGGT GGDGGRGAHG TLFSSLAGTG GTGGNGGTGG TGGAGGAGGT      1140
     GSTLGATGAT GAAGRAGNGG VGGSGGLGSA FGPGGTGGMG GAGGTSTVSA GGDGGRGGFG      1200
     GDGLDASSGG NGGDGGHGGD GFRTAGAGGR GGDGGKGADP GGLFPIPGAG GKGGTGGTGG      1260
     TAHLGPLAII GQSGQPGQFG SPGADGRGGA GGAGGGGGAG GSF                        1303
//

If you have problems or comments...

PBIL Back to PBIL home page