(data stored in ACNUC7421 zone)

EMBL: CP001658.PE60

CP001658.PE60        Location/Qualifiers
FT   CDS             64012..65070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23081"
FT                   /protein_id="ACT23081.1"
FT                   /translation="MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTA
FT                   YEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIR
FT                   ELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLR
FT                   MTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRY
FT                   GPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVS
FT                   AAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDR
FT                   IGVALDRILMTA"
     MITYGSGDLL RADTEALVNT VNCVGVMGKG IALQFKRRYP EMFTAYEKAC KRGEVTIGKM        60
     FVVDTGQLDG PKHIINFPTK KHWRAPSKLA YIDAGLIDLI RVIRELNIAS VAVPPLGVGN       120
     GGLDWEDVEQ RLVSAFQQLP DVDAVIYPPS GGSRAIEGVE GLRMTWGRAV ILEAMRRYLQ       180
     QRRAMEPWED PAGISHLEIQ KLMYFANEAD PDLALDFTPG RYGPYSERVR HLLQGMEGAF       240
     TVGLGDGTAR VLANQPISLT TKGTDAITDY LATDAAADRV SAAVDTVLRV IEGFEGPYGV       300
     ELLASTHWVA TREGAKEPAT AAAAVRKWTK RKGRIYSDDR IGVALDRILM TA               352
//

If you have problems or comments...

PBIL Back to PBIL home page