(data stored in ACNUC7421 zone)

EMBL: CP001658.PE604

CP001658.PE604       Location/Qualifiers
FT   CDS             complement(682137..684524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00592"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23625"
FT                   /protein_id="ACT23625.1"
FT                   /translation="MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLIT
FT                   RPQWVALEKSISEIVGVLSPSQSDLVYLGYGLAILALPFVILIGLIVSRQWKLLGAYAA
FT                   AGLMAVLPLSISSSRIAAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPWLPA
FT                   RWRHWWWALLLAFVPIHLVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAI
FT                   RALAKRGFAVSGLAVVRPAGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQL
FT                   WLKLTLRGTETAPLQASMRRAVEHRALMAIAFGDLGMANTTVIAVSPLDRGWTLYAHRP
FT                   ARGIGISECTKTTPTAHVWEALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGA
FT                   TDAQLQSDLAQLLVTTSALYDAEAAVTAAIDTFGKQAILAASRRLTKSAVPKRIRESIT
FT                   DPNAVIASTRAEVMRQTGADQIKAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFF
FT                   SQLRTANWWWALLGLAVSALTYVGAAAALWACADGLVGFWKLSIMQVANTFAATTTPAG
FT                   VGGLALSTRFLQKGGLTAVRATAAVALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPN
FT                   ATVLYLIAGVALGIVGTFLFVPKLRRWLATAVRPKLREVTNDLIALAREPKRLALIVLG
FT                   CAGTTLGAALALWASIEAFGGGTTFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGL
FT                   AAFGVPAALGVPSVLLYRLLTCWLPVFAGWQVMHWLTRHEMI"
     MRVDGRDIGV SGNLLQPLTR RTNDIIRAVL AAIYLVAVIT SSLITRPQWV ALEKSISEIV        60
     GVLSPSQSDL VYLGYGLAIL ALPFVILIGL IVSRQWKLLG AYAAAGLMAV LPLSISSSRI       120
     AAPRWHFDLS DRLATLLAQF LDDPRWIAML AAVLTVSGPW LPARWRHWWW ALLLAFVPIH       180
     LVVSAIVPAR SLLGLAVGWL VGALVVLVVG TPALEVPLDG AIRALAKRGF AVSGLAVVRP       240
     AGPGPLVLSA ACEQPNAGAC SEALIELYGP HQSGGGALRQ LWLKLTLRGT ETAPLQASMR       300
     RAVEHRALMA IAFGDLGMAN TTVIAVSPLD RGWTLYAHRP ARGIGISECT KTTPTAHVWE       360
     ALRTLHDQQI SHGDLCSAEI TVDNGAVLFG GFGEAEYGAT DAQLQSDLAQ LLVTTSALYD       420
     AEAAVTAAID TFGKQAILAA SRRLTKSAVP KRIRESITDP NAVIASTRAE VMRQTGADQI       480
     KAETITRFSR GQLIQLVLIG ALVYVAYPFI STVPTFFSQL RTANWWWALL GLAVSALTYV       540
     GAAAALWACA DGLVGFWKLS IMQVANTFAA TTTPAGVGGL ALSTRFLQKG GLTAVRATAA       600
     VALQQSVQVI VHLVLLILFS ALAGTSTDLS HFVPNATVLY LIAGVALGIV GTFLFVPKLR       660
     RWLATAVRPK LREVTNDLIA LAREPKRLAL IVLGCAGTTL GAALALWASI EAFGGGTTFV       720
     TVTVVTMVGG TLASAAPTPG GVGAVEAALI GGLAAFGVPA ALGVPSVLLY RLLTCWLPVF       780
     AGWQVMHWLT RHEMI                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page