(data stored in ACNUC7421 zone)

EMBL: CP001658.PE609

CP001658.PE609       Location/Qualifiers
FT   CDS             688284..689111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00597"
FT                   /product="MCE-family protein mce2B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23630"
FT                   /protein_id="ACT23630.1"
FT                   /translation="MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTH
FT                   VSGLRAGQFVRAAGVEVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYLNLIG
FT                   DRYLELGRGHSGQRLAPGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSII
FT                   TVFQGQGATINDILDQTASLTATLADRDHAIGEVVNNLNTVLATTVKHQTEFDRTVDKL
FT                   EVLITGLKNRADPLAAAAAHISSAAGTLADLLGRIVHCCTAASGTSRASSSRS"
     MKTTGTTIKL GIVWLVLSVF TVMIIVVFGQ VRFHHTTGYS AVFTHVSGLR AGQFVRAAGV        60
     EVGKVAKVTL IDGDKQVLVD FTVDRSLSLD QATTASIRYL NLIGDRYLEL GRGHSGQRLA       120
     PGATIPLEHT HPALDLDALL GGFRPLFQTL DPDKVNSIAS SIITVFQGQG ATINDILDQT       180
     ASLTATLADR DHAIGEVVNN LNTVLATTVK HQTEFDRTVD KLEVLITGLK NRADPLAAAA       240
     AHISSAAGTL ADLLGRIVHC CTAASGTSRA SSSRS                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page