(data stored in ACNUC7421 zone)

EMBL: CP001658.PE61

CP001658.PE61        Location/Qualifiers
FT   CDS             complement(65115..65495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23082"
FT                   /protein_id="ACT23082.1"
FT                   /translation="MESAESIQRLTEFEMKLKFARLSTAILGCAAALVFPASVASADPP
FT                   DPHQPDMTKGYCPGGRWGFGDLAVCDGEKYPDGSFWHQWMQTWFTGPQFYFDCVSGGEP
FT                   LPGPPPPGGCGGAIPSEQPNAP"
     MESAESIQRL TEFEMKLKFA RLSTAILGCA AALVFPASVA SADPPDPHQP DMTKGYCPGG        60
     RWGFGDLAVC DGEKYPDGSF WHQWMQTWFT GPQFYFDCVS GGEPLPGPPP PGGCGGAIPS       120
     EQPNAP                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page