(data stored in ACNUC7421 zone)

EMBL: CP001658.PE611

CP001658.PE611       Location/Qualifiers
FT   CDS             689311..690756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00599"
FT                   /product="MCE-family protein mce2C"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23632"
FT                   /protein_id="ACT23632.1"
FT                   /translation="MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQ
FT                   FADTGGINTGDKVEIAGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTDTILG
FT                   RKNLEIEPRGSEPLKPNGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSE
FT                   TFDQTAPHLSAALEGVKAFSDTVGRRGEQIEQLLANANRIARVLGDRSEQVNGLLVNAK
FT                   TLLAAFKQRSQALRILLTNVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELA
FT                   DVAVLLGRYTAALTEAVGSGPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAG
FT                   LPEFRWPDPNGTRFPNGAPPAAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDTPL
FT                   PCAGATVGPFGGPDFPAPLDVQPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPP
FT                   NAPPGARTQPLEPFPDGTGGSNQ"
     MRTLTEFNRG RVGMMGAVVT VLVVGVAQSF TSVPMLFATP TYYAQFADTG GINTGDKVEI        60
     AGVNVGLVRS LAIRGNRVLI GFSLPGKTIG MQSRAAIRTD TILGRKNLEI EPRGSEPLKP       120
     NGFLPLAQTT TPYQIYDAFV DVTKAATGWD IDAVKRSLNV LSETFDQTAP HLSAALEGVK       180
     AFSDTVGRRG EQIEQLLANA NRIARVLGDR SEQVNGLLVN AKTLLAAFKQ RSQALRILLT       240
     NVSEASAQVS GLITDNPNLN HVLAQLRTVS EELVKRKNEL ADVAVLLGRY TAALTEAVGS       300
     GPFFKAMVVN LLPYQILQPW VDAAFKKRGI DPENFWRSAG LPEFRWPDPN GTRFPNGAPP       360
     AAPPVREGTP KHPGPAVPPG TPCSYTPAAG ALPRPDTPLP CAGATVGPFG GPDFPAPLDV       420
     QPSPPNPDGP PPTPGILSAG RPGEPAPAVP GIPMPLPPNA PPGARTQPLE PFPDGTGGSN       480
     Q                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page