(data stored in ACNUC7421 zone)

EMBL: CP001658.PE617

CP001658.PE617       Location/Qualifiers
FT   CDS             complement(695920..697155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23638"
FT                   /protein_id="ACT23638.1"
FT                   /translation="MGVVERAIAPSVLAALADTPVVVVNGARQVGKTTLVARLDYPGSS
FT                   EVVSLDDVANRDAARDDPRAFVSRPVDTLVIDEAQLEPGLFRAIKAEVDRDRRPGRFLL
FT                   TGSARLLSAPDMADALVGRVEIIELWPFSQGERAGIADGFVDALFTAPRELIHGSDMRR
FT                   ADLVDRIATGGFPDIVARSPSRRRAWFDNYLTTATQSVIREISPIERLAEMPRVLRLCA
FT                   ARTGAELNVSALANDLSIPARTTAGYLALLEAAFLIHRVPAWSTNLSRKVIRRPKLVVS
FT                   DSGLACHLLGVTGATLDRPGRPLGPLLETFVANEIRKQLTWSTERPSLWHFRDRGGAEV
FT                   DLVLEHPDGRVCGIEVKATSTPRAEDLRGLRYLAERLDDRFQFGVLLTAAPEATPFGPT
FT                   LAALPVSTLWAG"
     MGVVERAIAP SVLAALADTP VVVVNGARQV GKTTLVARLD YPGSSEVVSL DDVANRDAAR        60
     DDPRAFVSRP VDTLVIDEAQ LEPGLFRAIK AEVDRDRRPG RFLLTGSARL LSAPDMADAL       120
     VGRVEIIELW PFSQGERAGI ADGFVDALFT APRELIHGSD MRRADLVDRI ATGGFPDIVA       180
     RSPSRRRAWF DNYLTTATQS VIREISPIER LAEMPRVLRL CAARTGAELN VSALANDLSI       240
     PARTTAGYLA LLEAAFLIHR VPAWSTNLSR KVIRRPKLVV SDSGLACHLL GVTGATLDRP       300
     GRPLGPLLET FVANEIRKQL TWSTERPSLW HFRDRGGAEV DLVLEHPDGR VCGIEVKATS       360
     TPRAEDLRGL RYLAERLDDR FQFGVLLTAA PEATPFGPTL AALPVSTLWA G                411
//

If you have problems or comments...

PBIL Back to PBIL home page