(data stored in ACNUC7421 zone)

EMBL: CP001658.PE626

CP001658.PE626       Location/Qualifiers
FT   CDS             702981..703451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23647"
FT                   /protein_id="ACT23647.1"
FT                   /translation="MLPGPGARRLTLGIIPEGGAHIDVPRKTVGAWQTADTMGIFQALP
FT                   DVWGGWRTECWEDRFEEQLIRCNGALRLPELDLAAGMDSAREWLRDRIFQRFSDSPAGQ
FT                   ILKLSELLADVGPGLVVSDDAVTNGGARPNNEEWARFVAACDLVRGAHAESA"
     MLPGPGARRL TLGIIPEGGA HIDVPRKTVG AWQTADTMGI FQALPDVWGG WRTECWEDRF        60
     EEQLIRCNGA LRLPELDLAA GMDSAREWLR DRIFQRFSDS PAGQILKLSE LLADVGPGLV       120
     VSDDAVTNGG ARPNNEEWAR FVAACDLVRG AHAESA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page