(data stored in ACNUC7421 zone)

EMBL: CP001658.PE629

CP001658.PE629       Location/Qualifiers
FT   CDS             704082..704309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03993"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03993"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23650"
FT                   /protein_id="ACT23650.1"
FT                   /translation="MEGQRLWAHRRPKGTGSAVIDVSLARRCEAHGYDYFRSDDPVAAA
FT                   GFVVSAVWSCGRGPGNATGSGRLPKPLRHS"
     MEGQRLWAHR RPKGTGSAVI DVSLARRCEA HGYDYFRSDD PVAAAGFVVS AVWSCGRGPG        60
     NATGSGRLPK PLRHS                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page