(data stored in ACNUC7421 zone)

EMBL: CP001658.PE633

CP001658.PE633       Location/Qualifiers
FT   CDS             complement(706213..706596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23655"
FT                   /protein_id="ACT23655.1"
FT                   /translation="MPDRPQHPTASRQSSMVSWNHGAAGWLHCVQCGSATNPTACLDWL
FT                   PPIHARSGPMYAEHDVVVLTRDVPDKSLIAGDVGAVVGRYAAGGYEVDFTAANGCTVAV
FT                   VTLAGDDIRPRRRREIPHVREVA"
     MPDRPQHPTA SRQSSMVSWN HGAAGWLHCV QCGSATNPTA CLDWLPPIHA RSGPMYAEHD        60
     VVVLTRDVPD KSLIAGDVGA VVGRYAAGGY EVDFTAANGC TVAVVTLAGD DIRPRRRREI       120
     PHVREVA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page