(data stored in ACNUC7421 zone)

EMBL: CP001658.PE635

CP001658.PE635       Location/Qualifiers
FT   CDS             complement(707200..709767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23657"
FT                   /protein_id="ACT23657.1"
FT                   /translation="MAEAFDATQAVARILAEHGPLSEDDIARRLLDSGVADPDAVLRAL
FT                   RLETEWPARQLVDDRWVWLPTLLAGRVFTHRLGADEAVHDMLGVTPDLDPIITLCEHEE
FT                   YGRLADGSAARIVLAGYDEELLERRGIPDEAIDPGGALLLEPGTLATLGAAAGDLVGVR
FT                   LTAAGLVLERIGTAGADTSVGARLAELVDPDEPAFFPAAVWTACVDDPAAFTEPVAPLR
FT                   EILDQHGLTHEDDWLAPGGFNFDAWRFENRCELLAFRHDLDPNDAVALYTLIKLHETMS
FT                   LLLEATDPDELPRDVLATAAETATETGSDSLVDLLGDIGAALADPLLAELLVAETVGTD
FT                   SGGAAALGLLTEMLEPKVPRAARVAVRWLRAVALDRIGDVEAAERELLAAESMDTEWPL
FT                   PLLDLARIASDRGDAERGLALLRRAGTEPDHPLVRLLERHRAQPRRDLGRNEACWCGSG
FT                   RKYKKCHLGREALPLAERVDWLYAKASQHALSGDWTGLLAEVSYERFRYADSDDEDALA
FT                   AALADPLVLDAVLFEGGAFAEFLEVRGSLLPDDERLLAEQWLLVERSVFEVEHVQPGEG
FT                   VIVRDVRTGDTHEVHERAASRQLRAGQLICARPVPAGDTMVFFGGIEPVALHERAVLIE
FT                   LLDDEPDPVTLVAQLSRRFAPPTLVNTEGDSLAICEASVRVDDPAGIQGALDGVYDRVD
FT                   GEEPPRWIEHVTNDGMLRVRATLVLDGDTLRVETNSEPRMDRVLATLTRLDPAMTVLDD
FT                   DRRPLRNTREAAALAEQMPVTGAGAPDPDSPELAAALEEFIRDYETSWLDQPIPALDGH
FT                   TPRQAADDPTRRADLIKLLDTFPAGAGARGGMDADRLRTALGL"
     MAEAFDATQA VARILAEHGP LSEDDIARRL LDSGVADPDA VLRALRLETE WPARQLVDDR        60
     WVWLPTLLAG RVFTHRLGAD EAVHDMLGVT PDLDPIITLC EHEEYGRLAD GSAARIVLAG       120
     YDEELLERRG IPDEAIDPGG ALLLEPGTLA TLGAAAGDLV GVRLTAAGLV LERIGTAGAD       180
     TSVGARLAEL VDPDEPAFFP AAVWTACVDD PAAFTEPVAP LREILDQHGL THEDDWLAPG       240
     GFNFDAWRFE NRCELLAFRH DLDPNDAVAL YTLIKLHETM SLLLEATDPD ELPRDVLATA       300
     AETATETGSD SLVDLLGDIG AALADPLLAE LLVAETVGTD SGGAAALGLL TEMLEPKVPR       360
     AARVAVRWLR AVALDRIGDV EAAERELLAA ESMDTEWPLP LLDLARIASD RGDAERGLAL       420
     LRRAGTEPDH PLVRLLERHR AQPRRDLGRN EACWCGSGRK YKKCHLGREA LPLAERVDWL       480
     YAKASQHALS GDWTGLLAEV SYERFRYADS DDEDALAAAL ADPLVLDAVL FEGGAFAEFL       540
     EVRGSLLPDD ERLLAEQWLL VERSVFEVEH VQPGEGVIVR DVRTGDTHEV HERAASRQLR       600
     AGQLICARPV PAGDTMVFFG GIEPVALHER AVLIELLDDE PDPVTLVAQL SRRFAPPTLV       660
     NTEGDSLAIC EASVRVDDPA GIQGALDGVY DRVDGEEPPR WIEHVTNDGM LRVRATLVLD       720
     GDTLRVETNS EPRMDRVLAT LTRLDPAMTV LDDDRRPLRN TREAAALAEQ MPVTGAGAPD       780
     PDSPELAAAL EEFIRDYETS WLDQPIPALD GHTPRQAADD PTRRADLIKL LDTFPAGAGA       840
     RGGMDADRLR TALGL                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page