(data stored in ACNUC7421 zone)

EMBL: CP001658.PE636

CP001658.PE636       Location/Qualifiers
FT   CDS             709707..710600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23656"
FT                   /protein_id="ACT23656.1"
FT                   /translation="MGHVRPGFSPRLGSHRTLRPRWPPYAAASRGLTSGTSRWGWPRLG
FT                   FGVVTAPTRWTLADGRELLFFSLPGPRTSGTAAERVARHAQAQTFAGDIRQRAIQLVVS
FT                   EQEVASKITAATAGIATTTFPETPSIDDTIIGNDNRDTGVRLVDVKQDGGTSPPPPFAP
FT                   WDTPDGTPPPGTGLSPTLQQMILGGDPANLTGQGLADNVQRFVQSLPANDPNTAWLRGQ
FT                   VADLQAHVADIEYARTHCSTNDWIDRTAQFASGAIVFSIGVLTAETGAGVVAAAAGGVG
FT                   AATAGVSLLQCLVGSK"
     MGHVRPGFSP RLGSHRTLRP RWPPYAAASR GLTSGTSRWG WPRLGFGVVT APTRWTLADG        60
     RELLFFSLPG PRTSGTAAER VARHAQAQTF AGDIRQRAIQ LVVSEQEVAS KITAATAGIA       120
     TTTFPETPSI DDTIIGNDNR DTGVRLVDVK QDGGTSPPPP FAPWDTPDGT PPPGTGLSPT       180
     LQQMILGGDP ANLTGQGLAD NVQRFVQSLP ANDPNTAWLR GQVADLQAHV ADIEYARTHC       240
     STNDWIDRTA QFASGAIVFS IGVLTAETGA GVVAAAAGGV GAATAGVSLL QCLVGSK          297
//

If you have problems or comments...

PBIL Back to PBIL home page