(data stored in ACNUC7421 zone)

EMBL: CP001658.PE638

CP001658.PE638       Location/Qualifiers
FT   CDS             complement(710836..711102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23660"
FT                   /protein_id="ACT23660.1"
FT                   /translation="MRIPGNRQCLLVQVLRQVDGSAHRLILTSLHRDARADAHRYSNGT
FT                   DHAGRAADEPAETAHEPCWVAARGLASQASRAMSATYRPSSFI"
     MRIPGNRQCL LVQVLRQVDG SAHRLILTSL HRDARADAHR YSNGTDHAGR AADEPAETAH        60
     EPCWVAARGL ASQASRAMSA TYRPSSFI                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page