(data stored in ACNUC7421 zone)

EMBL: CP001658.PE645

CP001658.PE645       Location/Qualifiers
FT   CDS             715544..716569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00631"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23666"
FT                   /protein_id="ACT23666.1"
FT                   /translation="MTVSRSSSAPSLARRARRCTGSDDAAMSFCVYCGAELADPTRCGA
FT                   CGAYKIGSTWHRTTTPTVGAATTATGWRPDPTGRHEGRYFVAGQPTDLVREGDAEAVDP
FT                   LGQQQLDQSGAVGVSPSAVSGWVRSGHRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRE
FT                   SIDDKYLAALRRSGLTGEFNSDANAIARGKQVCRQLQDGGEQQGMPVDQVAVQYYCPQF
FT                   SDGFHILETITVTGSFTLKDESPNVYAPAITVSGSGCSGSAGYADIDRGTQVTVKNGQG
FT                   DILATAFLQAGQGGRFLCTFPFSFEITEGEDRYVVSVSRRGEMSYSFADLKANGLSLVL
FT                   G"
     MTVSRSSSAP SLARRARRCT GSDDAAMSFC VYCGAELADP TRCGACGAYK IGSTWHRTTT        60
     PTVGAATTAT GWRPDPTGRH EGRYFVAGQP TDLVREGDAE AVDPLGQQQL DQSGAVGVSP       120
     SAVSGWVRSG HRRLWWALAG VVAFLGLVGA GVVGTLFLNR DRESIDDKYL AALRRSGLTG       180
     EFNSDANAIA RGKQVCRQLQ DGGEQQGMPV DQVAVQYYCP QFSDGFHILE TITVTGSFTL       240
     KDESPNVYAP AITVSGSGCS GSAGYADIDR GTQVTVKNGQ GDILATAFLQ AGQGGRFLCT       300
     FPFSFEITEG EDRYVVSVSR RGEMSYSFAD LKANGLSLVL G                           341
//

If you have problems or comments...

PBIL Back to PBIL home page