(data stored in ACNUC7421 zone)

EMBL: CP001658.PE648

CP001658.PE648       Location/Qualifiers
FT   CDS             complement(717405..718145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00634"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23669"
FT                   /protein_id="ACT23669.1"
FT                   /translation="MSTHNDSAPTSRRRHIVRLVVFAGFLVGMFYLVAATDVIDVAAVR
FT                   GAVSATGPAAPLTYVVVSAVLGALFVPGPILAASSGLLFGPLVGVFVTLGATVGTAVVA
FT                   SLVGRRAGRASARALLGGERADRTDALIERCGLWAVVGQRFVPGISDAFASYAFGTFGV
FT                   PLWQMAVGAFIGSAPRAFAYTALGAAIGDRSPLLASCAIAVWCVTAIIGAFAARHGYRQ
FT                   WRAHARGDGADGGVEDPDREVGAR"
     MSTHNDSAPT SRRRHIVRLV VFAGFLVGMF YLVAATDVID VAAVRGAVSA TGPAAPLTYV        60
     VVSAVLGALF VPGPILAASS GLLFGPLVGV FVTLGATVGT AVVASLVGRR AGRASARALL       120
     GGERADRTDA LIERCGLWAV VGQRFVPGIS DAFASYAFGT FGVPLWQMAV GAFIGSAPRA       180
     FAYTALGAAI GDRSPLLASC AIAVWCVTAI IGAFAARHGY RQWRAHARGD GADGGVEDPD       240
     REVGAR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page