(data stored in ACNUC7421 zone)

EMBL: CP001658.PE654

CP001658.PE654       Location/Qualifiers
FT   CDS             complement(725265..728558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00640"
FT                   /product="exonuclease subunit V gamma recC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23675"
FT                   /protein_id="ACT23675.1"
FT                   /translation="MALHLHRAERTDLLADGLGALLADPQPDPFAQELVLVAARGVERW
FT                   LSQRLSLVLGCGPGRADGVCAGIAFRNPQSLIAEITGTLDDDPWSPEALAWPLLAVIDA
FT                   SLDEPWCRTLASHLGHFATTDAEAELRRGRRYSVARRLAGLFASYARQRPGLLAAWLDG
FT                   DLGELPGDLAWQPPLWRALVTTVGADPPHVRHDKTIARLRDGPADLPARLSLFGHTRLA
FT                   CTDVQLLDALAVHHDLHLWLPHPSDELWRALAGFQGADGLLPRRQDTSRRAAQHPLLET
FT                   LGRDVRELQRALPAARATDEFLGATTKPDTLLGWLQADIAGNAPRPAGRSLSDADRSVQ
FT                   VHACHGPARQIDVLREVLLGLLEDDPTLQPRDIVVMCPDIDTYAPLIVAGFGLGEVAGD
FT                   CHPAHRLRVRLADRALTQTNPLLSVAAELLTIAETRATASQLLNLAQAAPVRAKFGFAD
FT                   DDLDTITTWVRESNIRWGFDPTHRRRYGLDTVVHNTWRFGLDRILTGVAMSEDSQAWLD
FT                   TALPLDDVGSNRVELAGMLAEFVERLHHVVGGLSGARPLVAWLDALATGIDLLTACNDG
FT                   WQRAQVQREFADVLARAGSRAAPLLRLPDVRALLDAQLAGRPTRANFRTGTLTVCTMVP
FT                   MRSVPHRVVCLVGLDDGVFPRLSHPDGDDVLAREPMTGERDIRSEDRQLLLDAIGAATQ
FT                   TLVITYTGADERTGQPRPPAVPLAELLDALDQTTSAPVRERILVTHPLQPFDRKNVTPG
FT                   ALLGAKPFTFDPAALAAAQAAAGKRCPPTAFISGRLPAPPAADVTLADLLDFFKDPVKG
FT                   FFRALDYTLPWDVDTVEDSIPVQVDALAEWTVGERMLRDMLRGLHPDDAAHSEWRRGTL
FT                   PPGRLGVRRAKEIRNRARDLAAAALAHRDGHGQAHDVDVDLGDGRRLSGTVTPVFGGRT
FT                   VSVTYSKLAPKHVLPAWIGLVTLAAQEPGREWSALCIGRSKTRNHIARRLFVPPPDPVA
FT                   VLRELVLLYDAGRREPLPLPLKTSCAWAQARRDGQDPYPPARECWQTNRFRPGDDDAPA
FT                   HVRAWGPRAPFEVLLGKPRAGEEVAGEETRLGALAARLWLPLLAAEGSV"
     MALHLHRAER TDLLADGLGA LLADPQPDPF AQELVLVAAR GVERWLSQRL SLVLGCGPGR        60
     ADGVCAGIAF RNPQSLIAEI TGTLDDDPWS PEALAWPLLA VIDASLDEPW CRTLASHLGH       120
     FATTDAEAEL RRGRRYSVAR RLAGLFASYA RQRPGLLAAW LDGDLGELPG DLAWQPPLWR       180
     ALVTTVGADP PHVRHDKTIA RLRDGPADLP ARLSLFGHTR LACTDVQLLD ALAVHHDLHL       240
     WLPHPSDELW RALAGFQGAD GLLPRRQDTS RRAAQHPLLE TLGRDVRELQ RALPAARATD       300
     EFLGATTKPD TLLGWLQADI AGNAPRPAGR SLSDADRSVQ VHACHGPARQ IDVLREVLLG       360
     LLEDDPTLQP RDIVVMCPDI DTYAPLIVAG FGLGEVAGDC HPAHRLRVRL ADRALTQTNP       420
     LLSVAAELLT IAETRATASQ LLNLAQAAPV RAKFGFADDD LDTITTWVRE SNIRWGFDPT       480
     HRRRYGLDTV VHNTWRFGLD RILTGVAMSE DSQAWLDTAL PLDDVGSNRV ELAGMLAEFV       540
     ERLHHVVGGL SGARPLVAWL DALATGIDLL TACNDGWQRA QVQREFADVL ARAGSRAAPL       600
     LRLPDVRALL DAQLAGRPTR ANFRTGTLTV CTMVPMRSVP HRVVCLVGLD DGVFPRLSHP       660
     DGDDVLAREP MTGERDIRSE DRQLLLDAIG AATQTLVITY TGADERTGQP RPPAVPLAEL       720
     LDALDQTTSA PVRERILVTH PLQPFDRKNV TPGALLGAKP FTFDPAALAA AQAAAGKRCP       780
     PTAFISGRLP APPAADVTLA DLLDFFKDPV KGFFRALDYT LPWDVDTVED SIPVQVDALA       840
     EWTVGERMLR DMLRGLHPDD AAHSEWRRGT LPPGRLGVRR AKEIRNRARD LAAAALAHRD       900
     GHGQAHDVDV DLGDGRRLSG TVTPVFGGRT VSVTYSKLAP KHVLPAWIGL VTLAAQEPGR       960
     EWSALCIGRS KTRNHIARRL FVPPPDPVAV LRELVLLYDA GRREPLPLPL KTSCAWAQAR      1020
     RDGQDPYPPA RECWQTNRFR PGDDDAPAHV RAWGPRAPFE VLLGKPRAGE EVAGEETRLG      1080
     ALAARLWLPL LAAEGSV                                                     1097
//

If you have problems or comments...

PBIL Back to PBIL home page