(data stored in ACNUC7421 zone)

EMBL: CP001658.PE658

CP001658.PE658       Location/Qualifiers
FT   CDS             731365..731616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00644"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23679"
FT                   /protein_id="ACT23679.1"
FT                   /translation="MGSDCGCGGYLWSMLKRVEIEVDDDLIQKVIRRYRVKGAREAVNL
FT                   ALRTLLGEADTAEHGHDDEYDEFSDPNAWVPRRSRDTG"
     MGSDCGCGGY LWSMLKRVEI EVDDDLIQKV IRRYRVKGAR EAVNLALRTL LGEADTAEHG        60
     HDDEYDEFSD PNAWVPRRSR DTG                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page