(data stored in ACNUC7421 zone)

EMBL: CP001658.PE660

CP001658.PE660       Location/Qualifiers
FT   CDS             732182..732658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23681"
FT                   /protein_id="ACT23681.1"
FT                   /translation="MALSADIVGMHYRYPDHYEVEREKIREYAVAVQNDDAWYFEEDGA
FT                   AELGYKGLLAPLTFICVFGYKAQAAFFKHANIATAEAQIVQVDQVLKFEKPIVAGDKLY
FT                   CDVYVDSVREAHGTQIIVTKNIVTNEEGDLVQETYTTLAGRAGEDGEGFSDGAA"
     MALSADIVGM HYRYPDHYEV EREKIREYAV AVQNDDAWYF EEDGAAELGY KGLLAPLTFI        60
     CVFGYKAQAA FFKHANIATA EAQIVQVDQV LKFEKPIVAG DKLYCDVYVD SVREAHGTQI       120
     IVTKNIVTNE EGDLVQETYT TLAGRAGEDG EGFSDGAA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page