(data stored in ACNUC7421 zone)

EMBL: CP001658.PE661

CP001658.PE661       Location/Qualifiers
FT   CDS             732576..733073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23682"
FT                   /protein_id="ACT23682.1"
FT                   /translation="MTSCRRPIRPWRAVPARMERDFLMALREFSSVKVGDQLPEKTYPL
FT                   TRQDLVNYAGVSGDLNPIHWDDEIAKVVGLDTAIAHGMLTMGIGGGYVTSWVGDPGAVT
FT                   EYNVRFTAVVPVPNDGKGAELVFNGRVKSVDPESKSVTIALTATTGGKKIFGRAIASAK
FT                   LA"
     MTSCRRPIRP WRAVPARMER DFLMALREFS SVKVGDQLPE KTYPLTRQDL VNYAGVSGDL        60
     NPIHWDDEIA KVVGLDTAIA HGMLTMGIGG GYVTSWVGDP GAVTEYNVRF TAVVPVPNDG       120
     KGAELVFNGR VKSVDPESKS VTIALTATTG GKKIFGRAIA SAKLA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page