(data stored in ACNUC7421 zone)

EMBL: CP001658.PE672

CP001658.PE672       Location/Qualifiers
FT   CDS             complement(741403..742869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23693"
FT                   /protein_id="ACT23693.1"
FT                   /translation="MRAEIGPDFRPHYTFGDAYPASERAHVNWELSAPVWHTAQMGSTT
FT                   HREVAKLDRVPLPVEAARVAATGWQVTRTAVRFIGRLPRKGPWQQKVIKELPQTFADLG
FT                   PTYVKFGQIIASSPGAFGESLSREFRGLLDRVPPAKTDEVHKLFVEELGDEPARLFASF
FT                   EEEPFASASIAQVHYATLRSGEEVVVKIQRPGIRRRVAADLQILKRFAQTVELAKLGRR
FT                   LSAQDVVADFADNLAEELDFRLEAQSMEAWVSHLHASPLGKNIRVPQVHWDFTTERVLT
FT                   MERVHGIRIDNAAAIRKAGFDGVELVKALLFSVFEGGLRHGLFHGDLHAGNLYVDEAGR
FT                   IVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMGAVGTMKPETQAAKDL
FT                   ERFATPLTMQSLGDMSYADIGRQLSALADAYDVKLPRELVLIGKQFLYVERYMKLLAPR
FT                   WQMMSDPQLTGYFANFMVEVSREHQSDIEV"
     MRAEIGPDFR PHYTFGDAYP ASERAHVNWE LSAPVWHTAQ MGSTTHREVA KLDRVPLPVE        60
     AARVAATGWQ VTRTAVRFIG RLPRKGPWQQ KVIKELPQTF ADLGPTYVKF GQIIASSPGA       120
     FGESLSREFR GLLDRVPPAK TDEVHKLFVE ELGDEPARLF ASFEEEPFAS ASIAQVHYAT       180
     LRSGEEVVVK IQRPGIRRRV AADLQILKRF AQTVELAKLG RRLSAQDVVA DFADNLAEEL       240
     DFRLEAQSME AWVSHLHASP LGKNIRVPQV HWDFTTERVL TMERVHGIRI DNAAAIRKAG       300
     FDGVELVKAL LFSVFEGGLR HGLFHGDLHA GNLYVDEAGR IVFFDFGIMG RIDPRTRWLL       360
     RELVYALLVK KDHAAAGKIV VLMGAVGTMK PETQAAKDLE RFATPLTMQS LGDMSYADIG       420
     RQLSALADAY DVKLPRELVL IGKQFLYVER YMKLLAPRWQ MMSDPQLTGY FANFMVEVSR       480
     EHQSDIEV                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page