(data stored in ACNUC7421 zone)

EMBL: CP001658.PE676

CP001658.PE676       Location/Qualifiers
FT   CDS             749061..749597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00662"
FT                   /product="50S ribosomal protein L10 rplJ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23697"
FT                   /protein_id="ACT23697.1"
FT                   /translation="MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTG
FT                   SATYAVAKNTLIKRAASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALV
FT                   IKGGYMDGHPLTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAA
FT                   ALQEKKACPGPDSAE"
     MARADKATAV ADIAAQFKES TATLITEYRG LTVANLAELR RSLTGSATYA VAKNTLIKRA        60
     ASEAGIEGLD ELFVGPTAIA FVTGEPVDAA KAIKTFAKEH KALVIKGGYM DGHPLTVAEV       120
     ERIADLESRE VLLAKLAGAM KGNLAKAAGL FNAPASQLAR LAAALQEKKA CPGPDSAE         178
//

If you have problems or comments...

PBIL Back to PBIL home page