(data stored in ACNUC7421 zone)

EMBL: CP001658.PE680

CP001658.PE680       Location/Qualifiers
FT   CDS             752302..753381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00666"
FT                   /product="ribonucleotide-transport ATP-binding protein ABC
FT                   transporter mkl"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00666"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23701"
FT                   /protein_id="ACT23701.1"
FT                   /translation="MRYSDSYHTTGRWQPRASTEGFPMGVSIEVNGLTKSFGSSRIWED
FT                   VTLTIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIIIDGTDIIECSAKELYEIRT
FT                   LFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIAMEKLALVGLGGDEKKFPGE
FT                   ISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTH
FT                   NINIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGMSEGKDEAT
FT                   MAEEQALLDAGHHAGGVEEIEGVPPQISATPGMPERKAVARRQARVREMLHTLPKKAQA
FT                   AILDDLEGTHKYAVHEIGQ"
     MRYSDSYHTT GRWQPRASTE GFPMGVSIEV NGLTKSFGSS RIWEDVTLTI PAGEVSVLLG        60
     PSGTGKSVFL KSLIGLLRPE RGSIIIDGTD IIECSAKELY EIRTLFGVLF QDGALFGSMN       120
     LYDNTAFPLR EHTKKKESEI RDIAMEKLAL VGLGGDEKKF PGEISGGMRK RAGLARALVL       180
     DPQIILCDEP DSGLDPVRTA YLSQLIMDIN AQIDATILIV THNINIARTV PDNMGMLFRK       240
     HLVMFGPREV LLTSDEPVVR QFLNGRRIGP IGMSEGKDEA TMAEEQALLD AGHHAGGVEE       300
     IEGVPPQISA TPGMPERKAV ARRQARVREM LHTLPKKAQA AILDDLEGTH KYAVHEIGQ        359
//

If you have problems or comments...

PBIL Back to PBIL home page