(data stored in ACNUC7421 zone)

EMBL: CP001658.PE683

CP001658.PE683       Location/Qualifiers
FT   CDS             complement(754478..755194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00669"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00669"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23704"
FT                   /protein_id="ACT23704.1"
FT                   /translation="MEAGRADTVAPSHRWGLGAFLVVELVFLVASTSLAVVLTGHGPVS
FT                   AGVLALALAAPTVVAAGLAILITRLHGNGPRTDLRLRWSWRGLRLGLMFGFGGMLVTIP
FT                   ASLVYTAIVGPEANSAVVRIFGGVRASWPWALVVFLVVVFVAPLCEEIIYRGLLWGAVD
FT                   RRWGRWAALVVTTVVFALAHLEFARAPLLVVVAIPIALARFYSGGLLASIVTHQVTNLL
FT                   PGIVLLLGLTGAISLP"
     MEAGRADTVA PSHRWGLGAF LVVELVFLVA STSLAVVLTG HGPVSAGVLA LALAAPTVVA        60
     AGLAILITRL HGNGPRTDLR LRWSWRGLRL GLMFGFGGML VTIPASLVYT AIVGPEANSA       120
     VVRIFGGVRA SWPWALVVFL VVVFVAPLCE EIIYRGLLWG AVDRRWGRWA ALVVTTVVFA       180
     LAHLEFARAP LLVVVAIPIA LARFYSGGLL ASIVTHQVTN LLPGIVLLLG LTGAISLP         238
//

If you have problems or comments...

PBIL Back to PBIL home page