(data stored in ACNUC7421 zone)

EMBL: CP001658.PE694

CP001658.PE694       Location/Qualifiers
FT   CDS             764155..768105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00680"
FT                   /product="DNA-directed RNA polymerase subunit beta rpoC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23715"
FT                   /protein_id="ACT23715.1"
FT                   /translation="MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDG
FT                   LFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVE
FT                   DQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDI
FT                   WSTFTKLAPKQLIVDENLYRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVI
FT                   RNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMK
FT                   RLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLV
FT                   EGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILSPASGRPLAM
FT                   PRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKV
FT                   RLTQLRPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQA
FT                   AIINDLAERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPRKKEILDHYEERA
FT                   DKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPIITIVDSGATGNFT
FT                   QTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSG
FT                   YLTRRLVDVSQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAV
FT                   DEAGNVIVERGQDLGDPEIDALLAAGITQVKVRSVLTCATSTGVCATCYGRSMATGKLV
FT                   DIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVPRGKAPIAD
FT                   VTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEV
FT                   GQQLMEGSADPHEVLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVT
FT                   IIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEPAAGRPVLMGITKASLATDSWLSAAS
FT                   FQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARAAAYT
FT                   IPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR"
     MLDVNFFDEL RIGLATAEDI RQWSYGEVKK PETINYRTLK PEKDGLFCEK IFGPTRDWEC        60
     YCGKYKRVRF KGIICERCGV EVTRAKVRRE RMGHIELAAP VTHIWYFKGV PSRLGYLLDL       120
     APKDLEKIIY FAAYVITSVD EEMRHNELST LEAEMAVERK AVEDQRDGEL EARAQKLEAD       180
     LAELEAEGAK ADARRKVRDG GEREMRQIRD RAQRELDRLE DIWSTFTKLA PKQLIVDENL       240
     YRELVDRYGE YFTGAMGAES IQKLIENFDI DAEAESLRDV IRNGKGQKKL RALKRLKVVA       300
     AFQQSGNSPM GMVLDAVPVI PPELRPMVQL DGGRFATSDL NDLYRRVINR NNRLKRLIDL       360
     GAPEIIVNNE KRMLQESVDA LFDNGRRGRP VTGPGNRPLK SLSDLLKGKQ GRFRQNLLGK       420
     RVDYSGRSVI VVGPQLKLHQ CGLPKLMALE LFKPFVMKRL VDLNHAQNIK SAKRMVERQR       480
     PQVWDVLEEV IAEHPVLLNR APTLHRLGIQ AFEPMLVEGK AIQLHPLVCE AFNADFDGDQ       540
     MAVHLPLSAE AQAEARILML SSNNILSPAS GRPLAMPRLD MVTGLYYLTT EVPGDTGEYQ       600
     PASGDHPETG VYSSPAEAIM AADRGVLSVR AKIKVRLTQL RPPVEIEAEL FGHSGWQPGD       660
     AWMAETTLGR VMFNELLPLG YPFVNKQMHK KVQAAIINDL AERYPMIVVA QTVDKLKDAG       720
     FYWATRSGVT VSMADVLVPP RKKEILDHYE ERADKVEKQF QRGALNHDER NEALVEIWKE       780
     ATDEVGQALR EHYPDDNPII TIVDSGATGN FTQTRTLAGM KGLVTNPKGE FIPRPVKSSF       840
     REGLTVLEYF INTHGARKGL ADTALRTADS GYLTRRLVDV SQDVIVREHD CQTERGIVVE       900
     LAERAPDGTL IRDPYIETSA YARTLGTDAV DEAGNVIVER GQDLGDPEID ALLAAGITQV       960
     KVRSVLTCAT STGVCATCYG RSMATGKLVD IGEAVGIVAA QSIGEPGTQL TMRTFHQGGV      1020
     GEDITGGLPR VQELFEARVP RGKAPIADVT GRVRLEDGER FYKITIVPDD GGEEVVYDKI      1080
     SKRQRLRVFK HEDGSERVLS DGDHVEVGQQ LMEGSADPHE VLRVQGPREV QIHLVREVQE      1140
     VYRAQGVSIH DKHIEVIVRQ MLRRVTIIDS GSTEFLPGSL IDRAEFEAEN RRVVAEGGEP      1200
     AAGRPVLMGI TKASLATDSW LSAASFQETT RVLTDAAINC RSDKLNGLKE NVIIGKLIPA      1260
     GTGINRYRNI AVQPTEEARA AAYTIPSYED QYYSPDFGAA TGAAVPLDDY GYSDYR          1316
//

If you have problems or comments...

PBIL Back to PBIL home page