(data stored in ACNUC7421 zone)

EMBL: CP001658.PE7

CP001658.PE7         Location/Qualifiers
FT   CDS             10016..10930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00007"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23028"
FT                   /protein_id="ACT23028.1"
FT                   /translation="MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPP
FT                   WQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQ
FT                   PDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSG
FT                   GRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAF
FT                   LYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATI
FT                   GAFVYNLITDLIGGIEVTLADRD"
     MTAPNEPGAL SKGDGPNADG LVDRGGAHRA ATGPGRIPDA GDPPPWQRAA TRQSQAGHRQ        60
     PPPVSHPEGR PTNPPAAADA RLNRFISGAS APVTGPAAAV RTPQPDPDAS LGCGDGSPAE       120
     AYASELPDLS GPTPRAPQRN PAPARPAEGG AGSRGDSAAG SSGGRSITAE SRDARVQLSA       180
     RRSRGPVRAS MQIRRIDPWS TLKVSLLLSV ALFFVWMITV AFLYLVLGGM GVWAKLNSNV       240
     GDLLNNASGS SAELVSSGTI FGGAFLIGLV NIVLMTALAT IGAFVYNLIT DLIGGIEVTL       300
     ADRD                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page