(data stored in ACNUC7421 zone)

EMBL: CP001658.PE710

CP001658.PE710       Location/Qualifiers
FT   CDS             782718..783188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00696"
FT                   /product="30S ribosomal protein S7 rpsG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00696"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23731"
FT                   /protein_id="ACT23731.1"
FT                   /translation="MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYG
FT                   ALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWL
FT                   VGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW"
     MPRKGPAPKR PLVNDPVYGS QLVTQLVNKV LLKGKKSLAE RIVYGALEQA RDKTGTDPVI        60
     TLKRALDNVK PALEVRSRRV GGATYQVPVE VRPDRSTTLA LRWLVGYSRQ RREKTMIERL       120
     ANEILDASNG LGASVKRRED THKMAEANRA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page