(data stored in ACNUC7421 zone)

EMBL: CP001658.PE717

CP001658.PE717       Location/Qualifiers
FT   CDS             complement(790808..791857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00703"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23738"
FT                   /protein_id="ACT23738.1"
FT                   /translation="MTGTEHLVHTLRSQGRVCTSSGSPMYRELLELVAADVESGGVFAS
FT                   ILADQKGAPEGQAVPLRLLGGLHRMVLDGRAPVLRRWYPSTGGTWQAEAAWPDIVRTAT
FT                   DQPESLRAALDRPPQTNEVGRSAALIGGLLIACLQFDLPIRLFEIGSSAGLNLRPDRYR
FT                   YRYLGGEWGLADSPVRIDNAWLGELPPTATVRIVERHGYDIAPIDVTSPDGELNALSYI
FT                   WPDQTDRLERLRGAIAVARNIPADLHRQAAHAAVAGMTLTDDALTVLWHSITWQYLPAD
FT                   ERAAIRAGIDALAAQADAHCPFVHLTLEPAHQRPGAQIKYLVRMRSWPGGHARVLGECH
FT                   PHGPPVTWQ"
     MTGTEHLVHT LRSQGRVCTS SGSPMYRELL ELVAADVESG GVFASILADQ KGAPEGQAVP        60
     LRLLGGLHRM VLDGRAPVLR RWYPSTGGTW QAEAAWPDIV RTATDQPESL RAALDRPPQT       120
     NEVGRSAALI GGLLIACLQF DLPIRLFEIG SSAGLNLRPD RYRYRYLGGE WGLADSPVRI       180
     DNAWLGELPP TATVRIVERH GYDIAPIDVT SPDGELNALS YIWPDQTDRL ERLRGAIAVA       240
     RNIPADLHRQ AAHAAVAGMT LTDDALTVLW HSITWQYLPA DERAAIRAGI DALAAQADAH       300
     CPFVHLTLEP AHQRPGAQIK YLVRMRSWPG GHARVLGECH PHGPPVTWQ                   349
//

If you have problems or comments...

PBIL Back to PBIL home page