(data stored in ACNUC7421 zone)

EMBL: CP001658.PE719

CP001658.PE719       Location/Qualifiers
FT   CDS             792615..792944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00705"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23740"
FT                   /protein_id="ACT23740.1"
FT                   /translation="MWGLLTVPAPAQARRADSSEFDPDRGWRLHPQVAVRPEPFGALLY
FT                   HFGTRKLSFLKNRTILAVVQTLADYPDIRSACRGAGVDDCDQDPYLHALSVLAGSNMLV
FT                   PRQTT"
     MWGLLTVPAP AQARRADSSE FDPDRGWRLH PQVAVRPEPF GALLYHFGTR KLSFLKNRTI        60
     LAVVQTLADY PDIRSACRGA GVDDCDQDPY LHALSVLAGS NMLVPRQTT                   109
//

If you have problems or comments...

PBIL Back to PBIL home page