(data stored in ACNUC7421 zone)

EMBL: CP001658.PE720

CP001658.PE720       Location/Qualifiers
FT   CDS             792941..794116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00706"
FT                   /product="coenzyme pqq synthesis protein E pqqE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00706"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23741"
FT                   /protein_id="ACT23741.1"
FT                   /translation="MTSPVPRLIEQFERGLDAPICLTWELTYACNLACVHCLSSSGKRD
FT                   PGELSTRQCKDIIDELERMQVFYVNIGGGEPTVRPDFWELVDYATAHHVGVKFSTNGVR
FT                   ITPEVATRLAATDYVDVQISLDGATAEVNDAIRGTGSFDMAVRALQNLAAAGFAGVKIS
FT                   VVITRRNVAQLDEFATLASRYGATLRITRLRPSGRGTDVWADLHPTADQQVQLYDWLVS
FT                   KGERVLTGDSFFHLAPLGQSGALAGLNMCGAGRVVCLIDPVGDVYACPFAIHDHFLAGN
FT                   VLSDGGFQNVWKNSSLFRELREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPE
FT                   CVQGHSEPALARERHLPRPRADHSRGRRVSKPVPLTLSMRPPKRPCNESPV"
     MTSPVPRLIE QFERGLDAPI CLTWELTYAC NLACVHCLSS SGKRDPGELS TRQCKDIIDE        60
     LERMQVFYVN IGGGEPTVRP DFWELVDYAT AHHVGVKFST NGVRITPEVA TRLAATDYVD       120
     VQISLDGATA EVNDAIRGTG SFDMAVRALQ NLAAAGFAGV KISVVITRRN VAQLDEFATL       180
     ASRYGATLRI TRLRPSGRGT DVWADLHPTA DQQVQLYDWL VSKGERVLTG DSFFHLAPLG       240
     QSGALAGLNM CGAGRVVCLI DPVGDVYACP FAIHDHFLAG NVLSDGGFQN VWKNSSLFRE       300
     LREPQSAGAC GSCGHYDSCR GGCMAAKFFT GLPLDGPDPE CVQGHSEPAL ARERHLPRPR       360
     ADHSRGRRVS KPVPLTLSMR PPKRPCNESP V                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page