(data stored in ACNUC7421 zone)

EMBL: CP001658.PE729

CP001658.PE729       Location/Qualifiers
FT   CDS             801593..802246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00714"
FT                   /product="50S ribosomal protein L3 rplC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00714"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23750"
FT                   /protein_id="ACT23750.1"
FT                   /translation="MARKGILGTKLGMTQVFDESNRVVPVTVVKAGPNVVTRIRTPERD
FT                   GYSAVQLAYGEISPRKVNKPLTGQYTAAGVNPRRYLAELRLDDSDAATEYQVGQELTAE
FT                   IFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKG
FT                   TRMAGRMGNDRVTVLNLLVHKVDAENGVLLIKGAVPGRTGGLVMVRSAIKRGEK"
     MARKGILGTK LGMTQVFDES NRVVPVTVVK AGPNVVTRIR TPERDGYSAV QLAYGEISPR        60
     KVNKPLTGQY TAAGVNPRRY LAELRLDDSD AATEYQVGQE LTAEIFADGS YVDVTGTSKG       120
     KGFAGTMKRH GFRGQGASHG AQAVHRRPGS IGGCATPARV FKGTRMAGRM GNDRVTVLNL       180
     LVHKVDAENG VLLIKGAVPG RTGGLVMVRS AIKRGEK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page