(data stored in ACNUC7421 zone)

EMBL: CP001658.PE730

CP001658.PE730       Location/Qualifiers
FT   CDS             802246..802917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00715"
FT                   /product="50S ribosomal protein L4 rplD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23751"
FT                   /protein_id="ACT23751.1"
FT                   /translation="MAAQEQKTLKIDVKTPAGKVDGAIELPAELFDVPANIALMHQVVT
FT                   AQRAAARQGTHSTKTRGEVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDY
FT                   SQRTPKKMIAAALRGALSDRARNGRIHAITELVEGQNPSTKSARAFLASLTERKQVLVV
FT                   IGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDVVFSVEALNAYIAANTTTSEEVS
FT                   A"
     MAAQEQKTLK IDVKTPAGKV DGAIELPAEL FDVPANIALM HQVVTAQRAA ARQGTHSTKT        60
     RGEVSGGGRK PYRQKGTGRA RQGSTRAPQF TGGGVVHGPK PRDYSQRTPK KMIAAALRGA       120
     LSDRARNGRI HAITELVEGQ NPSTKSARAF LASLTERKQV LVVIGRSDEA GAKSVRNLPG       180
     VHILAPDQLN TYDVLRADDV VFSVEALNAY IAANTTTSEE VSA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page