(data stored in ACNUC7421 zone)

EMBL: CP001658.PE731

CP001658.PE731       Location/Qualifiers
FT   CDS             802917..803219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00716"
FT                   /product="50S ribosomal protein L23 rplW"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00716"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23752"
FT                   /protein_id="ACT23752.1"
FT                   /translation="MATLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIA
FT                   VEKIFAVKVASVNTANRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA"
     MATLADPRDI ILAPVISEKS YGLLDDNVYT FLVRPDSNKT QIKIAVEKIF AVKVASVNTA        60
     NRQGKRKRTR TGYGKRKSTK RAIVTLAPGS RPIDLFGAPA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page