(data stored in ACNUC7421 zone)

EMBL: CP001658.PE735

CP001658.PE735       Location/Qualifiers
FT   CDS             805282..806106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00721"
FT                   /product="30S ribosomal protein S3 rpsC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23756"
FT                   /protein_id="ACT23756.1"
FT                   /translation="MGQKINPHGFRLGITTDWKSRWYADKQYAEYVKEDVAIRRLLSSG
FT                   LERAGIADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILE
FT                   VKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMS
FT                   RSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPAGA
FT                   DRPRRERPSGTRPRRSGASGTTATGTDAGRAAGGEEAAPDAAAPVEAQSTES"
     MGQKINPHGF RLGITTDWKS RWYADKQYAE YVKEDVAIRR LLSSGLERAG IADVEIERTR        60
     DRVRVDIHTA RPGIVIGRRG TEADRIRADL EKLTGKQVQL NILEVKNPES QAQLVAQGVA       120
     EQLSNRVAFR RAMRKAIQSA MRQPNVKGIR VQCSGRLGGA EMSRSEFYRE GRVPLHTLRA       180
     DIDYGLYEAK TTFGRIGVKV WIYKGDIVGG KRELAAAAPA GADRPRRERP SGTRPRRSGA       240
     SGTTATGTDA GRAAGGEEAA PDAAAPVEAQ STES                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page