(data stored in ACNUC7421 zone)

EMBL: CP001658.PE736

CP001658.PE736       Location/Qualifiers
FT   CDS             806110..806526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00722"
FT                   /product="50S ribosomal protein L16 rplP"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00722"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23757"
FT                   /protein_id="ACT23757.1"
FT                   /translation="MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNR
FT                   QIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLF
FT                   ELSYPNEGVARAALTRAIHKLPIKARIITREEQF"
     MLIPRKVKHR KQHHPRQRGI ASGGTTVNFG DYGIQALEHA YVTNRQIESA RIAINRHIKR        60
     GGKVWINIFP DRPLTKKPAE TRMGSGKGSP EWWVANVKPG RVLFELSYPN EGVARAALTR       120
     AIHKLPIKAR IITREEQF                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page