(data stored in ACNUC7421 zone)

EMBL: CP001658.PE737

CP001658.PE737       Location/Qualifiers
FT   CDS             806526..806759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00723"
FT                   /product="50S ribosomal protein L29 rpmC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00723"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23758"
FT                   /protein_id="ACT23758.1"
FT                   /translation="MAVGVSPGELRELTDEELAERLRESKEELFNLRFQMATGQLNNNR
FT                   RLRTVRQEIARIYTVLRERELGLATGPDGKES"
     MAVGVSPGEL RELTDEELAE RLRESKEELF NLRFQMATGQ LNNNRRLRTV RQEIARIYTV        60
     LRERELGLAT GPDGKES                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page