(data stored in ACNUC7421 zone)

EMBL: CP001658.PE742

CP001658.PE742       Location/Qualifiers
FT   CDS             812373..812741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00728"
FT                   /product="50S ribosomal protein L14 rplN"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00728"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23763"
FT                   /protein_id="ACT23763.1"
FT                   /translation="MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKD
FT                   AIPGGNVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGR
FT                   ELREKRFMKIISLAPEVL"
     MIQQESRLKV ADNTGAKEIL CIRVLGGSSR RYAGIGDVIV ATVKDAIPGG NVKRGDVVKA        60
     VVVRTVKERR RPDGSYIKFD ENAAVIIKPD NDPRGTRIFG PVGRELREKR FMKIISLAPE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page