(data stored in ACNUC7421 zone)

EMBL: CP001658.PE743

CP001658.PE743       Location/Qualifiers
FT   CDS             812742..813059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00729"
FT                   /product="50S ribosomal protein L24 rplX"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00729"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23764"
FT                   /protein_id="ACT23764.1"
FT                   /translation="MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHT
FT                   AISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKD
FT                   I"
     MKVHKGDTVL VISGKDKGAK GKVLQAYPDR NRVLVEGVNR IKKHTAISTT QRGARSGGIV        60
     TQEAPIHVSN VMVVDSDGKP TRIGYRVDEE TGKRVRISKR NGKDI                       105
//

If you have problems or comments...

PBIL Back to PBIL home page