(data stored in ACNUC7421 zone)

EMBL: CP001658.PE746

CP001658.PE746       Location/Qualifiers
FT   CDS             813976..814374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00732"
FT                   /product="30S ribosomal protein S8 rpsH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00732"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23767"
FT                   /protein_id="ACT23767.1"
FT                   /translation="MTMTDPIADFLTRLRNANSAYHDEVSLPHSKLKANIAQILKNEGY
FT                   ISDFRTEDARVGKSLVIQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGLGVA
FT                   IISTSSGLLTDRQAARQGVGGEVLAYVW"
     MTMTDPIADF LTRLRNANSA YHDEVSLPHS KLKANIAQIL KNEGYISDFR TEDARVGKSL        60
     VIQLKYGPSR ERSIAGLRRV SKPGLRVYAK STNLPRVLGG LGVAIISTSS GLLTDRQAAR       120
     QGVGGEVLAY VW                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page