(data stored in ACNUC7421 zone)

EMBL: CP001658.PE747

CP001658.PE747       Location/Qualifiers
FT   CDS             814398..814937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00733"
FT                   /product="50S ribosomal protein L6 rplF"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00733"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23768"
FT                   /protein_id="ACT23768.1"
FT                   /translation="MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVAR
FT                   NDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNL
FT                   EFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGV
FT                   RYEGEQIRRKVGKTGK"
     MSRIGKQPIP VPAGVDVTIE GQSISVKGPK GTLGLTVAEP IKVARNDDGA IVVTRPDDER        60
     RNRSLHGLSR TLVSNLVTGV TQGYTTKMEI FGVGYRVQLK GSNLEFALGY SHPVVIEAPE       120
     GITFAVQAPT KFTVSGIDKQ KVGQIAANIR RLRRPDPYKG KGVRYEGEQI RRKVGKTGK        179
//

If you have problems or comments...

PBIL Back to PBIL home page