(data stored in ACNUC7421 zone)

EMBL: CP001658.PE75

CP001658.PE75        Location/Qualifiers
FT   CDS             81807..82799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00073"
FT                   /product="glutamine-transport ATP-binding protein ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23096"
FT                   /protein_id="ACT23096.1"
FT                   /translation="MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCG
FT                   KTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVE
FT                   NVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPP
FT                   LILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAET
FT                   NRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEI
FT                   GVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND"
     MGDLSIQNLV VEYYSGGYAL RPINGLNLDV AAGSLVMLLG PSGCGKTTLL SCLGGILRPK        60
     SGAIKFDEVD ITTLQGAELA NYRRNKVGIV FQAFNLVPSL TAVENVMVPL RSAGMSRRAS       120
     RRRAEELLAR VNLAERMNHR PGDLSGGQQQ RVAVARAIAL DPPLILADEP TAHLDFIQVE       180
     EVLRLIRELA DGERVVVVAT HDSRMLPMAD RVVELTPDFA ETNRPPETVH LQAGEVLFEQ       240
     STMGDLIYVV SEGEFEIVHE LADGGEELVK VAGPGDYFGE IGVLFHLPRS ATVRARSDAT       300
     AVGYTVQAFR ERLGVGGLRD LIEHRALAND                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page