(data stored in ACNUC7421 zone)

EMBL: CP001658.PE755

CP001658.PE755       Location/Qualifiers
FT   CDS             complement(819537..820640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23776"
FT                   /protein_id="ACT23776.1"
FT                   /translation="MTYTGSIRCEGDTWDLASSVGATATMVAAARAMATRAANPLINDQ
FT                   FAEPLVRAVGVDVLTRLASGELTASDIDDPERPNASMVRMAEHHAVRTKFFDEFFMDAT
FT                   RAGIRQVVILASGLDSRAYRLAWPAQTVVYEIDQPQVMEFKTRTLAELGATPTADRRVV
FT                   TADLRADWPTALGAAGFDPTQPTAWSAEGLLRYLPPEAQDRLLDNVTALSVPDSRFATE
FT                   SIRNFKPHHEERMRERMTILANRWRAYGFDLDMNELVYFGDRNEPASYLSDNGWLLTEI
FT                   KSQDLLTANGFQPFEDEEVPLPDFFYVSARLQRKHRQYPAHRKPAPSWRHTACPVNELS
FT                   KSAAYTMTRSDAHQASTTAPPPPGLTG"
     MTYTGSIRCE GDTWDLASSV GATATMVAAA RAMATRAANP LINDQFAEPL VRAVGVDVLT        60
     RLASGELTAS DIDDPERPNA SMVRMAEHHA VRTKFFDEFF MDATRAGIRQ VVILASGLDS       120
     RAYRLAWPAQ TVVYEIDQPQ VMEFKTRTLA ELGATPTADR RVVTADLRAD WPTALGAAGF       180
     DPTQPTAWSA EGLLRYLPPE AQDRLLDNVT ALSVPDSRFA TESIRNFKPH HEERMRERMT       240
     ILANRWRAYG FDLDMNELVY FGDRNEPASY LSDNGWLLTE IKSQDLLTAN GFQPFEDEEV       300
     PLPDFFYVSA RLQRKHRQYP AHRKPAPSWR HTACPVNELS KSAAYTMTRS DAHQASTTAP       360
     PPPGLTG                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page