(data stored in ACNUC7421 zone)

EMBL: CP001658.PE759

CP001658.PE759       Location/Qualifiers
FT   CDS             823866..824594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00744"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00744"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23780"
FT                   /protein_id="ACT23780.1"
FT                   /translation="MHGARTGVSFYAYAMTDHDQTAARREIADALLAALERRHEVADAI
FT                   VEAANKAAAVEAIVNLLGTSHLAAEAVMSMSFDQLTQDARTKIIAELDDLNKQLSFTVK
FT                   ERPASSGEGLELRPFSPDEDRDIFARRTEEMGAAGDGSGGPAGSVDDEIRAAQKRVDDE
FT                   EAAWFVAVDSGVKVGMVFGELVHGEVDVRIWIHPDHRKKGYGTAALRKSRSEMAWAFPA
FT                   VPMVARAPAAQPAQPGSAGR"
     MHGARTGVSF YAYAMTDHDQ TAARREIADA LLAALERRHE VADAIVEAAN KAAAVEAIVN        60
     LLGTSHLAAE AVMSMSFDQL TQDARTKIIA ELDDLNKQLS FTVKERPASS GEGLELRPFS       120
     PDEDRDIFAR RTEEMGAAGD GSGGPAGSVD DEIRAAQKRV DDEEAAWFVA VDSGVKVGMV       180
     FGELVHGEVD VRIWIHPDHR KKGYGTAALR KSRSEMAWAF PAVPMVARAP AAQPAQPGSA       240
     GR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page