(data stored in ACNUC7421 zone)

EMBL: CP001658.PE765

CP001658.PE765       Location/Qualifiers
FT   CDS             829140..829892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00750"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23786"
FT                   /protein_id="ACT23786.1"
FT                   /translation="MTMPLRGLGPPDDTGVREVSTGDDHHYAMWDAAYVLGALSAADRR
FT                   EFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESAPTVVASGLSPELLPSLLA
FT                   AVHRRRRRTRLITWVASSAAAAVLAIGVLVGVQGHSAAPQRAAVSALPMAQVGTQLLAS
FT                   TVSISGEPWGTFINLRCVCLAPPYASHDTLAMVVVGRDGSQTRLATWLAEPGHTATPAG
FT                   SISTPVDQIAAVQVVAADTGQVLLQRSL"
     MTMPLRGLGP PDDTGVREVS TGDDHHYAMW DAAYVLGALS AADRREFEAH LAGCPECRGA        60
     VTELCGVPAL LSQLDRDEVA AISESAPTVV ASGLSPELLP SLLAAVHRRR RRTRLITWVA       120
     SSAAAAVLAI GVLVGVQGHS AAPQRAAVSA LPMAQVGTQL LASTVSISGE PWGTFINLRC       180
     VCLAPPYASH DTLAMVVVGR DGSQTRLATW LAEPGHTATP AGSISTPVDQ IAAVQVVAAD       240
     TGQVLLQRSL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page