(data stored in ACNUC7421 zone)

EMBL: CP001658.PE769

CP001658.PE769       Location/Qualifiers
FT   CDS             832695..833303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00754"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00754"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23790"
FT                   /protein_id="ACT23790.1"
FT                   /translation="MTGPPRSYTGRRDLIAEKLEPYFQISAMLPKNTRPTSETAEEFWD
FT                   NSLWCSWGDRETGYTRTVTVSICQVADGEREAEGVRDMMRLECPAGLDLRTPNPEAYEI
FT                   TGQRPGEFVFVLGYLGHVRAIVGNCYIEIMPMGTRVELSKLADVALDIGRSVGCSAYEN
FT                   DFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG"
     MTGPPRSYTG RRDLIAEKLE PYFQISAMLP KNTRPTSETA EEFWDNSLWC SWGDRETGYT        60
     RTVTVSICQV ADGEREAEGV RDMMRLECPA GLDLRTPNPE AYEITGQRPG EFVFVLGYLG       120
     HVRAIVGNCY IEIMPMGTRV ELSKLADVAL DIGRSVGCSA YENDFTLPDI PTQWRNQPLG       180
     WYTQGLAPYL PGLSDPKDAA EG                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page