(data stored in ACNUC7421 zone)

EMBL: CP001658.PE772

CP001658.PE772       Location/Qualifiers
FT   CDS             complement(834886..835443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00757"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23793"
FT                   /protein_id="ACT23793.1"
FT                   /translation="MTRQQLAHLLRRACAVVGDVDVLVLGSQSILGSFDENELPPQATA
FT                   SQEADIAFVNDPARDKADHVDVAIGEMSDFHRSNGVYAEGVHIDTAILPNGWRDRLVSW
FT                   TVESSRPAKPRFLEPHDLAVAKLAAGREKDKAFVAALIRSGLLDVGVIQARVLLLPEET
FT                   DPRIGQRIAAWLNYYGAGNHSS"
     MTRQQLAHLL RRACAVVGDV DVLVLGSQSI LGSFDENELP PQATASQEAD IAFVNDPARD        60
     KADHVDVAIG EMSDFHRSNG VYAEGVHIDT AILPNGWRDR LVSWTVESSR PAKPRFLEPH       120
     DLAVAKLAAG REKDKAFVAA LIRSGLLDVG VIQARVLLLP EETDPRIGQR IAAWLNYYGA       180
     GNHSS                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page