(data stored in ACNUC7421 zone)

EMBL: CP001658.PE777

CP001658.PE777       Location/Qualifiers
FT   CDS             839451..842054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00761"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23798"
FT                   /protein_id="ACT23798.1"
FT                   /translation="MSWVMVSPELVVAAAADLAGIGSAISSANAAAAVNTTGLLTAGAD
FT                   EVSTAIAALFGAQGQAYQAASAQAAAFYAQFVQALSAGGGAYAAAEAAAVSPLLAPINA
FT                   QFVAATGRPLIGNGANGAPGTGANGGPGGWLIGNGGAGGSGAPGAGAGGNGGAGGLFGS
FT                   GGAGGASTDVAGGAGGAGGAGGNAGMLFGAAGVGGVGGFSNGGATGGAGGAGGAGGLFG
FT                   AGGEGGSGGAGGASTDVAGGAGGAGGAGGNAGMLFGAAGVGGVGGFSNGGATGGAGGAG
FT                   GAGGLFGAGGEGGSGGSGNLTGGAGGAGGNAGTLATGDGGAGGTGGASRSGGFGGAGGA
FT                   GGDAGMFFGSGGSGGAGGISRSVGDGAAGGAGGAPGLIGNGGNGGNGGASTGGGDGGPG
FT                   GAGGTGVLIGNGGNGGSGGTGATLGKAGIGGTGGVLLGLDGFTAPASTSPLHTLQQDVI
FT                   NMVNDPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGQGTIGGVNGGAGGAG
FT                   GAGGILFGTGGTGGSGGPGATGLGGIGGAGGAALLFGSGGAGGSGGAGGVGGNGGAGGN
FT                   AGALLGAAGAGGAGGAGAVGGNGGAGGNGGLFANGGAGGPGGFGSPAGAGGIGGAGGNG
FT                   GLFGAGGTGGAGGGSTLAGGAGGAGGNGGLFGAGGTGGAGSHSTAAGVSGGAGGAGGDA
FT                   GLLSLGASGGAGGSGGSSLTAAGVVGGIGGAGGLLFGSGGAGGSGGFSNSGNGGAGGAG
FT                   GDAGLLVGSGGAGGAGASATGAATGGDGGAGGKSGAFGLGGDGGAGGATGLSGAFHIGG
FT                   KGGVGGSAVLIGNGGNGGNGGNSGNAGKSGGAPGPSGAGGAGGLLLGENGLNGLM"
     MSWVMVSPEL VVAAAADLAG IGSAISSANA AAAVNTTGLL TAGADEVSTA IAALFGAQGQ        60
     AYQAASAQAA AFYAQFVQAL SAGGGAYAAA EAAAVSPLLA PINAQFVAAT GRPLIGNGAN       120
     GAPGTGANGG PGGWLIGNGG AGGSGAPGAG AGGNGGAGGL FGSGGAGGAS TDVAGGAGGA       180
     GGAGGNAGML FGAAGVGGVG GFSNGGATGG AGGAGGAGGL FGAGGEGGSG GAGGASTDVA       240
     GGAGGAGGAG GNAGMLFGAA GVGGVGGFSN GGATGGAGGA GGAGGLFGAG GEGGSGGSGN       300
     LTGGAGGAGG NAGTLATGDG GAGGTGGASR SGGFGGAGGA GGDAGMFFGS GGSGGAGGIS       360
     RSVGDGAAGG AGGAPGLIGN GGNGGNGGAS TGGGDGGPGG AGGTGVLIGN GGNGGSGGTG       420
     ATLGKAGIGG TGGVLLGLDG FTAPASTSPL HTLQQDVINM VNDPFQTLTG RPLIGNGANG       480
     TPGTGADGGA GGWLFGNGGN GGQGTIGGVN GGAGGAGGAG GILFGTGGTG GSGGPGATGL       540
     GGIGGAGGAA LLFGSGGAGG SGGAGGVGGN GGAGGNAGAL LGAAGAGGAG GAGAVGGNGG       600
     AGGNGGLFAN GGAGGPGGFG SPAGAGGIGG AGGNGGLFGA GGTGGAGGGS TLAGGAGGAG       660
     GNGGLFGAGG TGGAGSHSTA AGVSGGAGGA GGDAGLLSLG ASGGAGGSGG SSLTAAGVVG       720
     GIGGAGGLLF GSGGAGGSGG FSNSGNGGAG GAGGDAGLLV GSGGAGGAGA SATGAATGGD       780
     GGAGGKSGAF GLGGDGGAGG ATGLSGAFHI GGKGGVGGSA VLIGNGGNGG NGGNSGNAGK       840
     SGGAPGPSGA GGAGGLLLGE NGLNGLM                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page