(data stored in ACNUC7421 zone)

EMBL: CP001658.PE780

CP001658.PE780       Location/Qualifiers
FT   CDS             843207..843476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00764"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00764"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23801"
FT                   /protein_id="ACT23801.1"
FT                   /translation="MGLNYLGQVRAIVGDCVIHIMPMGTGVELSKLADLALDIGRSVGC
FT                   SAYENDFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG"
     MGLNYLGQVR AIVGDCVIHI MPMGTGVELS KLADLALDIG RSVGCSAYEN DFTLPDIPTQ        60
     WRNQPLGWYT QGLAPYLPGL SDPKDAAEG                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page